TA338319 T-FABP / FABP9 antibody

Rabbit Polyclonal Anti-FABP9 Antibody

See related secondary antibodies

Search for all "T-FABP / FABP9"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish T-FABP / FABP9

Product Description for T-FABP / FABP9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish T-FABP / FABP9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for T-FABP / FABP9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fatty acid-binding protein 9, TLBP, Testis lipid-binding protein, Testis-type fatty acid-binding protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0Z7S8
Immunogen:
The immunogen for anti-FABP9 antibody is: synthetic peptide directed towards the middle region of Human FABP9. Synthetic peptide located within the following region: SFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEK.
GeneID:
646480
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for T-FABP / FABP9 (3 products)

Catalog No. Species Pres. Purity   Source  

T-FABP / FABP9

T-FABP / FABP9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

T-FABP / FABP9 (1-132, His-tag)

T-FABP / FABP9 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

T-FABP / FABP9 (1-132, His-tag)

T-FABP / FABP9 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for T-FABP / FABP9 (1 products)

Catalog No. Species Pres. Purity   Source  

FABP9 overexpression lysate

FABP9 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn