TA338300 DSN1 antibody

Rabbit Polyclonal Anti-DSN1 Antibody

See related secondary antibodies

Search for all "DSN1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DSN1

Product Description for DSN1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DSN1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DSN1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf172, Kinetochore-associated protein DSN1 homolog, MIS13, chromosome 20 open reading frame 172
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H410
Immunogen:
The immunogen for anti-DSN1 antibody is: synthetic peptide directed towards the C-terminal region of Human DSN1. Synthetic peptide located within the following region: MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFM.
GeneID:
79980
Application WB
Background This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Altertive splicing results in multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DSN1 (3 products)

Catalog No. Species Pres. Purity   Source  

DSN1 (transcript variant 3)

DSN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

DSN1 (transcript variant 1)

DSN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

DSN1 (transcript variant 5)

DSN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for DSN1 (2 products)

Catalog No. Species Pres. Purity   Source  

DSN1 overexpression lysate

DSN1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

DSN1 overexpression lysate

DSN1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn