TA338287 GPR35 antibody

Rabbit Polyclonal Anti-GPR35 Antibody

See related secondary antibodies

Search for all "GPR35"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Mouse, Rat GPR35

Product Description for GPR35

Rabbit anti Human, Mouse, Rat GPR35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR35

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 35, KYNA receptor, Kynurenic acid receptor
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HC97
Immunogen:
The immunogen for anti-GPR35 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR35. Synthetic peptide located within the following region: HNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAAR.
GeneID:
2859
Application WB
Background GPR35 acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn