TA338267 gamma 2 smooth muscle Actin / ACTG2 antibody

Rabbit Polyclonal Anti-ACTG2 Antibody

See related secondary antibodies

Search for all "gamma 2 smooth muscle Actin / ACTG2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish gamma 2 smooth muscle Actin / ACTG2

Product Description for gamma 2 smooth muscle Actin / ACTG2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish gamma 2 smooth muscle Actin / ACTG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for gamma 2 smooth muscle Actin / ACTG2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha-actin-3, Gamma-2-actin, Smooth muscle gamma-actin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P63267
Immunogen:
The immunogen for anti-ACTG2 antibody is: synthetic peptide directed towards the C-terminal region of Human ACTG2. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRK.
GeneID:
72
Application WB
Background Actins are highly conserved proteins that are involved in various types of cell motility and in the maintence of the cytoskeleton. Three types of actins, alpha, beta and gamma, have been identified in vertebrates. Alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton and as mediators of interl cell motility. This gene encodes actin gamma 2; a smooth muscle actin found in enteric tissues. Altertive splicing results in multiple transcript variants encoding distinct isoforms. Based on similarity to peptide cleavage of related actins, the mature protein of this gene is formed by removal of two N-termil peptides.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for gamma 2 smooth muscle Actin / ACTG2 (1 products)

Catalog No. Species Pres. Purity   Source  

ACTG2 overexpression lysate

ACTG2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn