TA338157 GPR22 antibody

Rabbit Polyclonal Anti-GPR22 Antibody

See related secondary antibodies

Search for all "GPR22"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat GPR22

Product Description for GPR22

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat GPR22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 22
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99680
Immunogen:
The immunogen for anti-GPR22 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR22. Synthetic peptide located within the following region: KVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSEIREKC.
GeneID:
2845
Application WB
Background This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn