TA338121 CD85e / LILRA3 antibody

Rabbit Polyclonal Anti-LILRA3 Antibody

See related secondary antibodies

Search for all "CD85e / LILRA3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Human CD85e / LILRA3

Product Description for CD85e / LILRA3

Rabbit anti Bovine, Human CD85e / LILRA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD85e / LILRA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CD85 antigen-like family member E, HM43/HM31, ILT-6, ILT6, Immunoglobulin-like transcript 6, LILRA3, LIR-4, LIR4, Leukocyte immunoglobulin-like receptor 4, Leukocyte immunoglobulin-like receptor subfamily A member 3, Monocyte inhibitory receptor HM43/HM31
Presentation Purified
Reactivity Bov, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6C8
Immunogen:
The immunogen for anti-LILRA3 antibody is: synthetic peptide directed towards the C-terminal region of Human LILRA3. Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE.
GeneID:
11026
Application WB
Background Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predomintly on monocytes and B cells and at lower levels on dendritic cells and tural killer (NK) cells. All LIRs in subfamily B have an inhibitory function. LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD85e / LILRA3 (2 products)

Catalog No. Species Pres. Purity   Source  

CD85e / LILRA3

CD85e / LILRA3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

CD85e / LILRA3 (transcript variant 1)

CD85e / LILRA3 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / $299.00
  OriGene Technologies, Inc.

Positive controls for CD85e / LILRA3 (2 products)

Catalog No. Species Pres. Purity   Source  

LILRA3 overexpression lysate

LILRA3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

LILRA3 overexpression lysate

LILRA3 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn