TA337970 ASPRV1 / SASP antibody

Rabbit Polyclonal Anti-Asprv1 Antibody

See related secondary antibodies

Search for all "ASPRV1 / SASP"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASPRV1 / SASP

Product Description for ASPRV1 / SASP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASPRV1 / SASP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASPRV1 / SASP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Retroviral-like aspartic protease 1, SASPase, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, TAPS, TPA-inducible aspartic proteinase-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q09PK2
Immunogen:
The immunogen for anti-Asprv1 antibody is: synthetic peptide directed towards the middle region of Mouse Asprv1. Synthetic peptide located within the following region: DVLQDHNAVLDFEHRTCTLKGKKFRLLPVGSSLEDEFDLELIEEEEESSA.
GeneID:
67855
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn