TA337654 MPP3 antibody

Rabbit Polyclonal Anti-MPP3 Antibody

See related secondary antibodies

Search for all "MPP3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat MPP3

Product Description for MPP3

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat MPP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MPP3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DLG3, Discs large homolog 3, MAGUK p55 subfamily member 3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13368
Immunogen:
The immunogen for anti-MPP3 antibody: synthetic peptide directed towards the middle region of human MPP3. Synthetic peptide located within the following region: GVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCL.
GeneID:
4356
Application WB
Background This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kise homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, sigling pathways, and intracellular junctions. This protein contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in sigl transduction. Altertively spliced transcript variants have been identified. One transcript variant is experimentally supported, but it doesn't encode a protein. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MPP3 (1 products)

Catalog No. Species Pres. Purity   Source  

MPP3 (transcript variant 1)

MPP3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for MPP3 (1 products)

Catalog No. Species Pres. Purity   Source  

MPP3 overexpression lysate

MPP3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn