TA337603 PHACTR3 antibody

Rabbit Polyclonal Anti-PHACTR3 Antibody

See related secondary antibodies

Search for all "PHACTR3"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PHACTR3

Product Description for PHACTR3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PHACTR3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PHACTR3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf101, Phosphatase and actin regulator 3, SCAPIN1, Scaffold-associated PP1-inhibiting protein, Scapinin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KR7
Immunogen:
The immunogen for anti-PHACTR3 antibody: synthetic peptide directed towards the C terminal of human PHACTR3. Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR.
GeneID:
116154
Application WB
Background PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Altertive splicing at this locus results in several transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn