TA337557 Beta-klotho / KLB antibody

Rabbit Polyclonal Anti-KLB Antibody

See related secondary antibodies

Search for all "Beta-klotho / KLB"

0.1 ml / $360.00
Delivery Time: 10-15 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Beta-klotho / KLB

TA337557

More Views

  • TA337557
  • TA337557

Product Description for Beta-klotho / KLB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Beta-klotho / KLB.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Beta-klotho / KLB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BKL, Klotho beta-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86Z14
Immunogen:
The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG.
GeneID:
152831
Application WB
IHC
Background KLB is a single-pass type III membrane protein. It contributes to the transcriptiol repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably ictive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn