TA337379 KIAA0748 antibody

Rabbit Polyclonal Anti-TESPA1 Antibody

See related secondary antibodies

Search for all "KIAA0748"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit KIAA0748

Product Description for KIAA0748

Rabbit anti Canine, Equine, Human, Porcine, Rabbit KIAA0748.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0748

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A2RU30
Immunogen:
The immunogen for Anti-TESPA1 antibody is: synthetic peptide directed towards the C-terminal region of Human TESPA1. Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF.
GeneID:
9840
Application WB
Background TESPA1 is required for the development and maturation of T-cells, its function being essential for the late stages of thymocyte development. It plays a role in T-cell antigen receptor (TCR)-mediated activation of the ERK and NFAT sigling pathways, possibly by serving as a scaffolding protein that promotes the assembly of the LAT siglosome in thymocytes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn