TA337376 KIAA0355 antibody

Rabbit Polyclonal Anti-KIAA0355 Antibody

See related secondary antibodies

Search for all "KIAA0355"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KIAA0355

Product Description for KIAA0355

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KIAA0355.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0355

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15063
Immunogen:
The immunogen for Anti-KIAA0355 antibody is: synthetic peptide directed towards the C-terminal region of Human KIAA0355. Synthetic peptide located within the following region: DSASSSDETSSANGDSLFSMFSGPDLVAAVKQRRKHSSGEQDTSTLPSPP.
GeneID:
9710
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn