TA337310 FGD5 antibody

Rabbit Polyclonal Anti-FGD5 Antibody

See related secondary antibodies

Search for all "FGD5"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rat FGD5

Product Description for FGD5

Rabbit anti Canine, Equine, Human, Mouse, Rat FGD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGD5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FYVE, RhoGEF and PH domain-containing protein 5, ZFYVE23, Zinc finger FYVE domain-containing protein 23
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZNL6
Immunogen:
The immunogen for Anti-FGD5 antibody is: synthetic peptide directed towards the C-terminal region of Human FGD5. Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK.
GeneID:
152273
Application WB
Background FGD5 activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. It mediates VEGF-induced CDC42 activation. It may regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directiol movement and proliferation and may play a role in regulating the actin cytoskeleton and cell shape.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FGD5 (1 products)

Catalog No. Species Pres. Purity   Source  

FGD5 overexpression lysate

FGD5 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn