TA337299 ZMYND11 antibody

Rabbit Polyclonal Anti-ZMYND11 Antibody

See related secondary antibodies

Search for all "ZMYND11"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZMYND11

TA337299

More Views

  • TA337299
  • TA337299

Product Description for ZMYND11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZMYND11.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZMYND11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adenovirus 5 E1A-binding protein, BS69, Zinc finger MYND domain-containing protein 11
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15326
Immunogen:
The immunogen for anti-ZMYND11 antibody: synthetic peptide directed towards the N terminal of human ZMYND11. Synthetic peptide located within the following region: KKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNT.
GeneID:
10771
Application WB
IHC
Background ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptiol repressor, and expression of E1A inhibits this repression.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZMYND11 (1 products)

Catalog No. Species Pres. Purity   Source  

ZMYND11 overexpression lysate

ZMYND11 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn