TA337258 TRIM8 / GERP / RNF27 antibody

Rabbit Polyclonal Anti-TRIM8 Antibody

See related secondary antibodies

Search for all "TRIM8 / GERP / RNF27"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRIM8 / GERP / RNF27

Product Description for TRIM8 / GERP / RNF27

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRIM8 / GERP / RNF27.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM8 / GERP / RNF27

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glioblastoma-expressed RING finger protein, RING finger protein 27, Tripartite motif-containing protein 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZR9
Immunogen:
The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the middle region of human TRIM8. Synthetic peptide located within the following region: QSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGE.
GeneID:
81603
Application WB
Background This protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to nuclear bodies. Its structure is similar to some tumor suppressor proteins and its gene maps to a locus thought to contain tumor suppressor genes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM8 / GERP / RNF27 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIM8 / GERP / RNF27

TRIM8 / GERP / RNF27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn