TA337247 ZNF148 antibody

Rabbit Polyclonal Anti-ZNF148 Antibody

See related secondary antibodies

Search for all "ZNF148"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish ZNF148

TA337247

More Views

  • TA337247

Product Description for ZNF148

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish ZNF148.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF148

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transcription factor ZBP-89, ZBP89, Zinc finger DNA-binding protein 89, Zinc finger protein 148
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UQR1
Immunogen:
The immunogen for anti-ZNF148 antibody: synthetic peptide directed towards the middle region of human ZNF148. Synthetic peptide located within the following region: RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKS.
GeneID:
7707
Application WB
Background ZNF148 is involved in transcriptiol regulation. ZNF148 represses the transcription of a number of genes including gastrin, stromelysin and enolase. ZNF148 binds to the G-rich box in the enhancer region of these genes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF148 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF148

ZNF148 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for ZNF148 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF148 overexpression lysate

ZNF148 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn