TA337246 Kelch-like protein 12 antibody

Rabbit Polyclonal Anti-KLHL12 Antibody

See related secondary antibodies

Search for all "Kelch-like protein 12"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Kelch-like protein 12

Product Description for Kelch-like protein 12

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Kelch-like protein 12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Kelch-like protein 12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C3IP1, CUL3-interacting protein 1, KLHL12
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53G59
Immunogen:
The immunogen for Anti-KLHL12 antibody is: synthetic peptide directed towards the N-terminal region of Human KLHL12. Synthetic peptide located within the following region: EKGKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKG.
GeneID:
59349
Application WB
Background KLHL12 is a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of Wnt sigling pathway and ER-Golgi transport. The BCR(KLHL12) complex is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitition of SEC31 (SEC31A or SEC31B). As part of the BCR(KLHL12) complex, also acts as a negative regulator of the Wnt sigling pathway by mediating ubiquitition and subsequent proteolysis of DVL3. The BCR(KLHL12) complex also mediates polyubiquitition of DRD4, without leading to degradation of DRD4.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn