TA336224 CD213a2 / IL13RA2 antibody

Rabbit Polyclonal Anti-IL13RA2 Antibody

See related secondary antibodies

Search for all "CD213a2 / IL13RA2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human, Rabbit, Rat CD213a2 / IL13RA2

Product Description for CD213a2 / IL13RA2

Rabbit anti Human, Rabbit, Rat CD213a2 / IL13RA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD213a2 / IL13RA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IL-13R-alpha-2, IL-13RA-2, IL13 receptor alpha-2, IL13R, IL13RA2, Interleukin-13 receptor alpha-2 chain, Interleukin-13-binding protein
Presentation Purified
Reactivity Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14627
Immunogen:
The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP.
GeneID:
3598
Application WB
Background IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a sigl mediator. It is reported to play a role in the interlization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a sigl mediator. It is reported to play a role in the interlization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD213a2 / IL13RA2 (2 products)

Catalog No. Species Pres. Purity   Source  

CD213a2 / IL13RA2 (27-343, His-tag)

CD213a2 / IL13RA2 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

CD213a2 / IL13RA2 (27-343, His-tag)

CD213a2 / IL13RA2 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for CD213a2 / IL13RA2 (1 products)

Catalog No. Species Pres. Purity   Source  

IL13RA2 overexpression lysate

IL13RA2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn