TA336160 WDR33 antibody

Rabbit Polyclonal Anti-WDR33 Antibody

See related secondary antibodies

Search for all "WDR33"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish WDR33

TA336160

More Views

  • TA336160
  • TA336160

Product Description for WDR33

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish WDR33.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR33

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WD repeat-containing protein 33, WD repeat-containing protein WDC146, WDC146
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9C0J8
Immunogen:
The immunogen for Anti-WDR33 Antibody: synthetic peptide directed towards the middle region of human WDR33. Synthetic peptide located within the following region: TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL.
GeneID:
55339
Application WB
Background WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, sigl transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or D recombition.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, sigl transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or D recombition. Multiple altertively spliced transcript variants encoding distinct isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn