TA336109 GRAMD2 antibody

Rabbit Polyclonal Anti-GRAMD2 Antibody

See related secondary antibodies

Search for all "GRAMD2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat GRAMD2

Product Description for GRAMD2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat GRAMD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GRAMD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GRAM domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUY3
Immunogen:
The immunogen for Anti-GRAMD2 Antibody: synthetic peptide directed towards the middle region of human GRAMD2. Synthetic peptide located within the following region: LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF.
GeneID:
196996
Application WB
Background The exact function of GRAMD2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GRAMD2 (1 products)

Catalog No. Species Pres. Purity   Source  

GRAMD2 overexpression lysate

GRAMD2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn