TA336043 CYB5RL antibody

Rabbit Polyclonal Anti-CYB5RL Antibody

See related secondary antibodies

Search for all "CYB5RL"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat CYB5RL

Product Description for CYB5RL

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat CYB5RL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYB5RL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NADH-cytochrome b5 reductase-like
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IPT4
Immunogen:
The immunogen for Anti-CYB5RL Antibody: synthetic peptide directed towards the N terminal of human LOC606495. Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD.
GeneID:
606495
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CYB5RL (1 products)

Catalog No. Species Pres. Purity   Source  

CYB5RL overexpression lysate

CYB5RL overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn