TA336004 ARL17B antibody

Rabbit Polyclonal Anti-ARL17 Antibody

See related secondary antibodies

Search for all "ARL17B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ARL17B

Product Description for ARL17B

Rabbit anti Human ARL17B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARL17B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor 7 variant, ADP-ribosylation factor-like protein 17, ARL17A, ARL17P1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVW1
Immunogen:
The immunogen for Anti-ARL17 Antibody: synthetic peptide directed towards the middle region of human ARL17. Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD.
GeneID:
100506084
Application WB
Background ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ARL17B (1 products)

Catalog No. Species Pres. Purity   Source  

ARL17A overexpression lysate

ARL17A overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn