TA335992 Kremen protein 1 antibody

Rabbit Polyclonal Anti-KREMEN1 Antibody

See related secondary antibodies

Search for all "Kremen protein 1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Kremen protein 1

Product Description for Kremen protein 1

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Kremen protein 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Kremen protein 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Dickkopf receptor, KREMEN, KREMEN1, KRM1, Kringle domain-containing transmembrane protein 1, Kringle-containing protein marking the eye and the nose
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MU8
Immunogen:
The immunogen for Anti-KREMEN1 Antibody: synthetic peptide directed towards the N terminal of human KREMEN1. Synthetic peptide located within the following region: LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG.
GeneID:
83999
Application WB
Background KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functiolly cooperates with DKK1 to block wingless (WNT)/beta-catenin sigling. It is a component of a membrane complex that modulates canonical WNT sigling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functiolly cooperates with DKK1 to block wingless (WNT)/beta-catenin sigling. The encoded protein is a component of a membrane complex that modulates canonical WNT sigling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Altertively spliced transcript variants encoding distinct isoforms have been observed for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Kremen protein 1 (1 products)

Catalog No. Species Pres. Purity   Source  

KREMEN1 overexpression lysate

KREMEN1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn