TA335963 Sucrase-isomaltase (SI) antibody

Rabbit Polyclonal Anti-SI Antibody

See related secondary antibodies

Search for all "Sucrase-isomaltase (SI)"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Rat Sucrase-isomaltase (SI)

Product Description for Sucrase-isomaltase (SI)

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Rat Sucrase-isomaltase (SI).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Sucrase-isomaltase (SI)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Sucrase isomaltase intestinal
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14410
Immunogen:
The immunogen for Anti-SI Antibody: synthetic peptide directed towards the middle region of human SI. Synthetic peptide located within the following region: LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY.
GeneID:
6476
Application WB
Background SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the fil stage of carbohydrate digestion.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn