TA335929 KIAA1191 antibody

Rabbit Polyclonal Anti-KIAA1191 Antibody

See related secondary antibodies

Search for all "KIAA1191"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Human KIAA1191

Product Description for KIAA1191

Rabbit anti Canine, Human KIAA1191.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA1191

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain-derived rescue factor p60MONOX, UPF0498 protein KIAA1191, p60MONOX
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A73
Immunogen:
The immunogen for Anti-KIAA1191 Antibody: synthetic peptide directed towards the middle region of human KIAA1191. Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP.
GeneID:
57179
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA1191 (2 products)

Catalog No. Species Pres. Purity   Source  

KIAA1191 (transcript variant 3)

KIAA1191 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

KIAA1191 (transcript variant 1)

KIAA1191 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for KIAA1191 (2 products)

Catalog No. Species Pres. Purity   Source  

KIAA1191 overexpression lysate

KIAA1191 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

KIAA1191 overexpression lysate

KIAA1191 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn