TA335925 C16orf90 antibody

Rabbit Polyclonal Anti-C16orf90 Antibody

See related secondary antibodies

Search for all "C16orf90"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C16orf90

Product Description for C16orf90

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C16orf90.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C16orf90

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MZG2
Immunogen:
The immunogen for Anti-C16orf90 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf90. Synthetic peptide located within the following region: APPNIYEGGLGSPQPQCPSAQGSKPKNFRLRHLRGLGLYLESHPPPTGQC.
GeneID:
646174
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C16orf90 (1 products)

Catalog No. Species Pres. Purity   Source  

C16orf90 overexpression lysate

C16orf90 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn