TA335900 CPSF4L antibody

Rabbit Polyclonal Anti-CPSF4L Antibody

See related secondary antibodies

Search for all "CPSF4L"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Equine, Human, Rabbit, Rat CPSF4L

Product Description for CPSF4L

Rabbit anti Equine, Human, Rabbit, Rat CPSF4L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CPSF4L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative cleavage and polyadenylation specificity factor subunit 4-like protein
Presentation Purified
Reactivity Eq, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NMK7
Immunogen:
The immunogen for Anti-CPSF4L Antibody is: synthetic peptide directed towards the N-terminal region of Human CPSF4L. Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM.
GeneID:
642843
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CPSF4L (1 products)

Catalog No. Species Pres. Purity   Source  

CPSF4L overexpression lysate

CPSF4L overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn