TA335864 ADAM2 / FTNB antibody

Rabbit Polyclonal Anti-ADAM2 Antibody

See related secondary antibodies

Search for all "ADAM2 / FTNB"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human ADAM2 / FTNB

Product Description for ADAM2 / FTNB

Rabbit anti Human ADAM2 / FTNB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ADAM2 / FTNB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cancer/testis antigen 15, Disintegrin and metalloproteinase domain-containing protein 2, Fertilin subunit beta, PH-30, PH30-beta
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99965
Immunogen:
Synthetic peptide directed towards the middle region of human ADAM2
AA Sequence:
PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
GeneID:
2515
Application Western blotting (0.2 - 1.0 µg/ml)
Background ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
General Readings Eto,K., (2002) J. Biol. Chem. 277 (20), 17804-17810
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ADAM2 / FTNB (1 products)

Catalog No. Species Pres. Purity   Source  

ADAM2 overexpression lysate

ADAM2 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn