TA335849 FOXN2 / HTLF antibody

Rabbit Polyclonal Anti-HTLF Antibody

See related secondary antibodies

Search for all "FOXN2 / HTLF"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit FOXN2 / HTLF

Product Description for FOXN2 / HTLF

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit FOXN2 / HTLF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXN2 / HTLF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Forkhead box protein N2, Human T-cell leukemia virus enhancer factor
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P32314
Immunogen:
The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the N terminal of human HTLF. Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN.
GeneID:
3344
Application WB
Background Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptiol regulation of the human T-cell leukemia virus long termil repeat.Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptiol regulation of the human T-cell leukemia virus long termil repeat.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXN2 / HTLF (1 products)

Catalog No. Species Pres. Purity   Source  

FOXN2 / HTLF

FOXN2 / HTLF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for FOXN2 / HTLF (1 products)

Catalog No. Species Pres. Purity   Source  

FOXN2 overexpression lysate

FOXN2 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn