TA335841 LDHC antibody

Rabbit Polyclonal Anti-LDHC Antibody

See related secondary antibodies

Search for all "LDHC"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat LDHC

Product Description for LDHC

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat LDHC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LDHC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CT32, Cancer/testis antigen 32, EC=1.1.1.27, L-lactate dehydrogenase C chain, LDH testis subunit, LDH-C, LDH-X, LDHC
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P07864
Immunogen:
The immunogen for Anti-LDHC Antibody: synthetic peptide directed towards the middle region of human LDHC. Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV.
GeneID:
3948
Application WB
Background Lactate dehydrogese C catalyzes the conversion of L-lactate and D to pyruvate and DH in the fil step of aerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogese family.Lactate dehydrogese C catalyzes the conversion of L-lactate and D to pyruvate and DH in the fil step of aerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogese family. Two transcript variants have been detected which differ in the 5' untranslated region.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LDHC (2 products)

Catalog No. Species Pres. Purity   Source  

LDHC (transcript variant 1)

LDHC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

LDHC (transcript variant 2)

LDHC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for LDHC (2 products)

Catalog No. Species Pres. Purity   Source  

LDHC overexpression lysate

LDHC overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

LDHC overexpression lysate

LDHC overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn