TA335803 PSMC5 / SUG1 antibody

Rabbit Polyclonal Anti-PSMC5 Antibody

See related secondary antibodies

Search for all "PSMC5 / SUG1"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat PSMC5 / SUG1

TA335803

More Views

  • TA335803
  • TA335803
  • TA335803

Product Description for PSMC5 / SUG1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat PSMC5 / SUG1.
Presentation: Purified
Product is tested for Immunoprecipitation, Paraffin Sections, Western blot / Immunoblot.

Properties for PSMC5 / SUG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 26S protease regulatory subunit 8, Proteasome subunit p45, SUG-1, TBP10, TRIP1, Thyroid hormone receptor-interacting protein 1, p45/SUG
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Por, Rb, Rt
Applications IP, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62195
Immunogen:
The immunogen for Anti-PSMC5 Antibody: synthetic peptide directed towards the C terminal of human PSMC5. Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK.
GeneID:
5705
Application WB
IHC
IP
Background The 26S proteasome is a multicatalytic proteise complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptiol regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMC5 / SUG1 (1 products)

Catalog No. Species Pres. Purity   Source  

PSMC5 / SUG1

PSMC5 / SUG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn