TA335773 DNALI1 antibody

Rabbit Polyclonal Anti-DNALI1 Antibody

See related secondary antibodies

Search for all "DNALI1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit DNALI1

TA335773

More Views

  • TA335773

Product Description for DNALI1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit DNALI1.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for DNALI1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Axonemal dynein light intermediate polypeptide 1, HP28, Inner dynein arm light chain axonemal
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14645
Immunogen:
The immunogen for Anti-DNALI1 Antibody: synthetic peptide directed towards the N terminal of human DNALI1. Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA.
GeneID:
7802
Application WB
IF
Background DLI1 is the human homolog of the Chlamydomos inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomos, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomos inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomos, a biflagellated algae, exhibit similar defects.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNALI1 (3 products)

Catalog No. Species Pres. Purity   Source  

DNALI1

DNALI1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

DNALI1 (1-280, His-tag)

DNALI1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

DNALI1 (1-280, His-tag)

DNALI1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for DNALI1 (1 products)

Catalog No. Species Pres. Purity   Source  

DNALI1 overexpression lysate

DNALI1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn