TA335753 MED17 antibody

Rabbit Polyclonal Anti-MED17 Antibody

See related secondary antibodies

Search for all "MED17"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat MED17

TA335753

More Views

  • TA335753
  • TA335753
  • TA335753

Product Description for MED17

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat MED17.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MED17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARC77, Activator-recruited cofactor 77 kDa component, CRSP complex subunit 6, CRSP6, Cofactor required for Sp1 transcriptional activation subunit 6, DRIP77, DRIP80, Mediator complex subunit 17, Mediator of RNA polymerase II transcription subunit 17, TRAP80, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Vitamin D3 receptor-interacting protein complex 80 kDa component
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVC6
Immunogen:
The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG.
GeneID:
9440
Application WB
IHC
assay
Background The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptiol enhancer sites in D. These factors work with co-activators to direct transcriptiol initiation by the R polymerase II apparatus. The protein encoded by CRSP6 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on D templates in conjunction with initiation factors and cofactors.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn