TA335736 WDR39 / CIAO1 antibody

Rabbit Polyclonal Anti-CIAO1 Antibody

See related secondary antibodies

Search for all "WDR39 / CIAO1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat WDR39 / CIAO1

TA335736

More Views

  • TA335736
  • TA335736
  • TA335736

Product Description for WDR39 / CIAO1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat WDR39 / CIAO1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for WDR39 / CIAO1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WD repeat-containing protein 39
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O76071
Immunogen:
The immunogen for Anti-CIAO1 Antibody: synthetic peptide directed towards the middle region of human CIAO1. Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH.
GeneID:
9391
Application WB
IHC
Background CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WDR39 / CIAO1 (3 products)

Catalog No. Species Pres. Purity   Source  

WDR39 / CIAO1

WDR39 / CIAO1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

WDR39 / CIAO1 (1-339, His-tag)

WDR39 / CIAO1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

WDR39 / CIAO1 (1-339, His-tag)

WDR39 / CIAO1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

Positive controls for WDR39 / CIAO1 (1 products)

Catalog No. Species Pres. Purity   Source  

CIAO1 overexpression lysate

CIAO1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn