discontinued

TA335731 Cystinosin antibody

Rabbit Polyclonal Anti-Ctns Antibody

See related secondary antibodies

Search for all "Cystinosin"

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Cystinosin

TA335731

Product Description for Cystinosin

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Cystinosin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cystinosin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CTNS
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60931
Immunogen:
The immunogen for Anti-Ctns Antibody is: synthetic peptide directed towards the middle region of Mouse Ctns. Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP.
GeneID:
1497
Application WB
Background Ctns is thought to transport cystine out of lysosomes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cystinosin (1 products)

Catalog No. Species Pres. Purity   Source  

Cystinosin (transcript variant 2)

Cystinosin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for Cystinosin (3 products)

Catalog No. Species Pres. Purity   Source  

CTNS overexpression lysate

CTNS overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

CTNS overexpression lysate

CTNS overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

CTNS overexpression lysate

CTNS overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn