TA335676 TRIM10 / RNF9 antibody

Rabbit Polyclonal Anti-TRIM10 Antibody

See related secondary antibodies

Search for all "TRIM10 / RNF9"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat TRIM10 / RNF9

Product Description for TRIM10 / RNF9

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat TRIM10 / RNF9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM10 / RNF9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B30-RING finger protein, RFB30, RING finger protein 9, Tripartite motif-containing protein 10
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UDY6
Immunogen:
The immunogen for Anti-TRIM10 Antibody: synthetic peptide directed towards the middle region of human TRIM10. Synthetic peptide located within the following region: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT.
GeneID:
10107
Application WB
Background TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in termil differentiation of erythroid cells. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in termil differentiation of erythroid cells. Alterte splicing of this gene generates two transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM10 / RNF9 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIM10 / RNF9 (transcript variant 2)

TRIM10 / RNF9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for TRIM10 / RNF9 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM10 overexpression lysate

TRIM10 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

TRIM10 overexpression lysate

TRIM10 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn