TA335598 FEM1B antibody

Rabbit Polyclonal Anti-FEM1B Antibody

See related secondary antibodies

Search for all "FEM1B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat FEM1B

TA335598

More Views

  • TA335598
  • TA335598

Product Description for FEM1B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat FEM1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FEM1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F1A-alpha, F1AA, FEM1-beta, Fem-1-like death receptor-binding protein alpha, KIAA0396, Protein fem-1 homolog B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UK73
Immunogen:
The immunogen for Anti-FEM1B Antibody: synthetic peptide directed towards the C terminal of human FEM1B. Synthetic peptide located within the following region: DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH.
GeneID:
10116
Application WB
Background FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FEM1B (1 products)

Catalog No. Species Pres. Purity   Source  

FEM1B

FEM1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for FEM1B (1 products)

Catalog No. Species Pres. Purity   Source  

FEM1B overexpression lysate

FEM1B overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn