TA335588 SAMD4A / SMAUG1 antibody

Rabbit Polyclonal Anti-SAMD4A Antibody

See related secondary antibodies

Search for all "SAMD4A / SMAUG1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SAMD4A / SMAUG1

TA335588

More Views

  • TA335588
  • TA335588

Product Description for SAMD4A / SMAUG1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SAMD4A / SMAUG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SAMD4A / SMAUG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1053, SAM domain-containing protein 4A, SAMD4, Smaug 1, Smaug homolog 1, Sterile alpha motif domain-containing protein 4A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPU9
Immunogen:
The immunogen for Anti-SAMD4A Antibody: synthetic peptide directed towards the middle region of human SAMD4A. Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK.
GeneID:
23034
Application WB
Background Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an R-binding domain that functions as a posttranscriptiol regulator by binding to an R sequence motif known as the Smaug recognition element, which was med after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an R-binding domain that functions as a posttranscriptiol regulator by binding to an R sequence motif known as the Smaug recognition element, which was med after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SAMD4A / SMAUG1 (1 products)

Catalog No. Species Pres. Purity   Source  

SAMD4A / SMAUG1

SAMD4A / SMAUG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for SAMD4A / SMAUG1 (1 products)

Catalog No. Species Pres. Purity   Source  

SAMD4A overexpression lysate

SAMD4A overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.
  • LinkedIn