TA335560 RNF141 antibody

Rabbit Polyclonal Anti-RNF141 Antibody

See related secondary antibodies

Search for all "RNF141"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat RNF141

Product Description for RNF141

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat RNF141.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF141

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 141, ZNF230, Zinc finger protein 230
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVD5
Immunogen:
The immunogen for Anti-RNF141 Antibody: synthetic peptide directed towards the middle region of human RNF141. Synthetic peptide located within the following region: RIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGR.
GeneID:
50862
Application WB
Background RNF141 contains a RING finger, a motif known to be involved in protein-D and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF141 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF141

RNF141 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.
  • LinkedIn