TA335348 IMPDH1 / IMPD1 antibody

Rabbit Polyclonal Anti-IMPDH1 Antibody

See related secondary antibodies

Search for all "IMPDH1 / IMPD1"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish IMPDH1 / IMPD1

TA335348

More Views

  • TA335348
  • TA335348

Product Description for IMPDH1 / IMPD1

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish IMPDH1 / IMPD1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for IMPDH1 / IMPD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IMP dehydrogenase 1, IMPD 1, IMPDH 1, IMPDH-1, IMPDH-I, Inosine-5'-monophosphate dehydrogenase 1
Presentation Purified
Reactivity Can, Eq, Hu, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P20839
Immunogen:
The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE.
GeneID:
3614
Application WB
IHC
Background IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IMPDH1 / IMPD1 (4 products)

Catalog No. Species Pres. Purity   Source  

IMPDH1 / IMPD1 (transcript variant 2)

IMPDH1 / IMPD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

IMPDH1 / IMPD1 (transcript variant 1)

IMPDH1 / IMPD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

IMPDH1 / IMPD1 (1-514, His-tag)

IMPDH1 / IMPD1 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / $1,070.00
  OriGene Technologies GmbH

IMPDH1 / IMPD1 (1-514, His-tag)

IMPDH1 / IMPD1 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / $400.00
  OriGene Technologies GmbH

Positive controls for IMPDH1 / IMPD1 (4 products)

Catalog No. Species Pres. Purity   Source  

IMPDH1 overexpression lysate

IMPDH1 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

IMPDH1 overexpression lysate

IMPDH1 overexpression lysate
0.1 mg / $495.00
  OriGene Technologies, Inc.

IMPDH1 overexpression lysate

IMPDH1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.

IMPDH1 overexpression lysate

IMPDH1 overexpression lysate
0.1 mg / $315.00
  OriGene Technologies, Inc.
  • LinkedIn