TA335261 KITLG / SCF antibody

Rabbit Polyclonal Anti-KITLG Antibody

See related secondary antibodies

Search for all "KITLG / SCF"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep KITLG / SCF

TA335261

More Views

  • TA335261

Product Description for KITLG / SCF

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep KITLG / SCF.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KITLG / SCF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KITL, Kit ligand, MGF, Mast cell growth factor, Stem cell factor, c-Kit ligand
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P21583
Immunogen:
The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG.
GeneID:
4254
Application WB
IHC
Background KITLG is the ligand of the tyrosine-kise receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kise receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KITLG / SCF (13 products)

Catalog No. Species Pres. Purity   Source  

KITLG / SCF (transcript variant a)

KITLG / SCF Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
  OriGene Technologies, Inc.

KITLG / SCF (transcript variant b)

KITLG / SCF Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / $230.00
  OriGene Technologies, Inc.

KITLG / SCF (transcript variant b)

KITLG / SCF Human > 98 %
Preparation: .
Purity Detail: >98%, as determined by Coomassie stained SDS-PAGE.
E. coli
10 µg / $255.00
  OriGene Technologies, Inc.

KITLG / SCF

SDS-PAGE analysis of recombinant human SCF. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue. Human Purified > 95 % 95% by SDS-PAGE and visualised by silver stain Insect cells
5 µg / $200.00
  OriGene Technologies GmbH

KITLG / SCF (His-tag)

SDS-PAGE analysis of recombinant human SCF. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue. Human Purified > 95 % 95% by SDS-PAGE and visualised by silver stain Insect cells
20 µg / $360.00
  OriGene Technologies GmbH

KITLG / SCF (His-tag)

SDS-PAGE analysis of recombinant human SCF. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue. Human Purified > 95 % 95% by SDS-PAGE and visualised by silver stain Insect cells
50 µg / $500.00
  OriGene Technologies GmbH

KITLG / SCF

KITLG / SCF Human Purified > 98 % > 98% by RP-HPLC, Anion-exchange FPLC, Silver stain E. coli
10 µg / $230.00
  OriGene Technologies GmbH

KITLG / SCF

KITLG / SCF Human Purified > 98 % > 98% by RP-HPLC, Anion-exchange FPLC, Silver stain E. coli
2 µg / $150.00
  OriGene Technologies GmbH

KITLG / SCF

KITLG / SCF Human Purified > 98 % > 98% by RP-HPLC, Anion-exchange FPLC, Silver stain E. coli
50 µg / $400.00
  OriGene Technologies GmbH

KITLG / SCF (soluble form)

KITLG / SCF Human > 98 % E. coli
  OriGene Technologies GmbH

KITLG / SCF (soluble form)

KITLG / SCF Human > 98 % E. coli
  OriGene Technologies GmbH

KITLG / SCF

KITLG / SCF Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH

KITLG / SCF

KITLG / SCF Human Purified > 95 % by SDS-PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH
  • LinkedIn