TA335240 UGT1A1 antibody

Rabbit Polyclonal Anti-UGT1A1 Antibody

See related secondary antibodies

Search for all "UGT1A1"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat, Sheep UGT1A1

Product Description for UGT1A1

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat, Sheep UGT1A1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UGT1A1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Bilirubin-specific UDPGT isozyme 1, GNT1, HUG-BR1, UDP-glucuronosyltransferase 1-1, UDP-glucuronosyltransferase 1A1, UDPGT, UGT-1A, UGT1, UGT1-01, UGT1A
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P22309
Immunogen:
The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH.
GeneID:
54658
Application WB
Background UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alterte first exons followed by four common exons. Four of the alterte first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-jjar syndromes types I and II and in Gilbert syndrome.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UGT1A1 (3 products)

Catalog No. Species Pres. Purity   Source  

UGT1A1

UGT1A1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

UGT1A1 (26-490, His-tag)

UGT1A1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / $820.00
  OriGene Technologies GmbH

UGT1A1 (26-490, His-tag)

UGT1A1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / $320.00
  OriGene Technologies GmbH
  • LinkedIn