TA335198 GTF2H4 antibody

Rabbit Polyclonal Anti-GTF2H4 Antibody

See related secondary antibodies

Search for all "GTF2H4"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Porcine GTF2H4

Product Description for GTF2H4

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Porcine GTF2H4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GTF2H4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTF2-p52, Basic transcription factor 2 52 kDa subunit, General transcription factor IIH polypeptide 4, General transcription factor IIH subunit 4, TFIIH, TFIIH basal transcription factor complex p52 subunit
Presentation Purified
Reactivity Bov, Can, GP, Gt, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92759
Immunogen:
The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPS.
GeneID:
2968
Application WB
Background GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of D and, when complexed to CAK, in R transcription by R polymerase II.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2H4 (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2H4 (full length, N-term HIS tag)

GTF2H4 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.
  • LinkedIn