TA335185 BTF3 antibody

Rabbit Polyclonal Anti-BTF3 Antibody

See related secondary antibodies

Search for all "BTF3"

0.1 ml / $300.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat BTF3

Product Description for BTF3

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat BTF3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTF3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NACB, OK/SW-cl.8, RNA polymerase B transcription factor 3, Transcription factor BTF3
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P20290
Immunogen:
The immunogen for anti-BTF3 antibody: synthetic peptide directed towards the middle region of human BTF3. Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN.
GeneID:
689
Application WB
Background BTF3 forms a stable complex with R polymerase IIB and is required for transcriptiol initiation. Altertive splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTF3 (2 products)

Catalog No. Species Pres. Purity   Source  

BTF3 (1-209, His-tag)

BTF3 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / $820.00
  OriGene Technologies GmbH

BTF3 (1-209, His-tag)

BTF3 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / $320.00
  OriGene Technologies GmbH

Positive controls for BTF3 (2 products)

Catalog No. Species Pres. Purity   Source  

BTF3 overexpression lysate

BTF3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.

BTF3 overexpression lysate

BTF3 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn