TA335182 TOP2B antibody

Rabbit Polyclonal Anti-TOP2B Antibody

See related secondary antibodies

Search for all "TOP2B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat TOP2B

Product Description for TOP2B

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat TOP2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TOP2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA topoisomerase 2-beta, DNA topoisomerase II beta isozyme
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02880
Immunogen:
The immunogen for anti-TOP2B antibody: synthetic peptide directed towards the middle region of human TOP2B. Synthetic peptide located within the following region: ENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGR.
GeneID:
7155
Application WB
Background TOP2B is a D topoisomerase, an enzyme that controls and alters the topologic states of D during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsiol stress that occurs during D transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex D which allows the strands to pass through one another, thus altering the topology of D. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.This gene encodes a D topoisomerase, an enzyme that controls and alters the topologic states of D during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsiol stress that occurs during D transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex D which allows the strands to pass through one another, thus altering the topology of D. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, beta, is localized to chromosome 3 and the alpha form is localized to chromosome 17. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. Altertive splicing of this gene results in two transcript variants; however, the second variant has not yet been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn