TA335139 Peroxin 7 / PEX7 antibody

Rabbit polyclonal Anti-PEX7 Antibody

See related secondary antibodies

Search for all "Peroxin 7 / PEX7"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit Peroxin 7 / PEX7

Product Description for Peroxin 7 / PEX7

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit Peroxin 7 / PEX7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Peroxin 7 / PEX7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PTS2 receptor, PTS2R, Peroxin-7, Peroxisomal targeting signal 2 receptor
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00628
Immunogen:
The immunogen for anti-PEX7 antibody: synthetic peptide directed towards the N terminal of human PEX7. Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI.
GeneID:
5191
Application WB
Background PEX7 binds to the N-termil PTS2-type peroxisomal targeting sigl and plays an essential role in peroxisomal protein import.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn