TA335116 TMED8 / FAM15B antibody

Rabbit polyclonal Anti-TMED8 Antibody

See related secondary antibodies

Search for all "TMED8 / FAM15B"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine TMED8 / FAM15B

Product Description for TMED8 / FAM15B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine TMED8 / FAM15B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMED8 / FAM15B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PL24
Immunogen:
The immunogen for anti-TMED8 antibody: synthetic peptide directed towards the middle region of human TMED8. Synthetic peptide located within the following region: EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI.
GeneID:
283578
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMED8 / FAM15B (1 products)

Catalog No. Species Pres. Purity   Source  

TMED8 / FAM15B

TMED8 / FAM15B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for TMED8 / FAM15B (1 products)

Catalog No. Species Pres. Purity   Source  

TMED8 overexpression lysate

TMED8 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn