TA335104 CYP4V2 antibody

Rabbit polyclonal Anti-CYP4V2 Antibody

See related secondary antibodies

Search for all "CYP4V2"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit CYP4V2

Product Description for CYP4V2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit CYP4V2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYP4V2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytochrome P450 4V2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZWL3
Immunogen:
The immunogen for anti-CYP4V2 antibody: synthetic peptide directed towards the middle region of human CYP4V2. Synthetic peptide located within the following region: RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI.
GeneID:
285440
Application WB
Background CYP4V2 may have a role in fatty acid and steroid metabolism.This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretil dystrophy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn