TA334976 TBC1D28 antibody

Rabbit Polyclonal Anti-TBC1D28 Antibody

See related secondary antibodies

Search for all "TBC1D28"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Human TBC1D28

Product Description for TBC1D28

Rabbit anti Human TBC1D28.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TBC1D28

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TBC1 domain family member 28
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2M2D7
Immunogen:
The immunogen for anti-TBC1D28 antibody is: synthetic peptide directed towards the middle region of Human TBC1D28. Synthetic peptide located within the following region: QKMLADWTKYRSTKKLSQRVCKVIPLAVRGRALSLLLDIDKIKSQNPGKY.
GeneID:
254272
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TBC1D28 (1 products)

Catalog No. Species Pres. Purity   Source  

TBC1D28 (full length, N-term HIS tag)

TBC1D28 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / $205.00
  OriGene Technologies, Inc.

Positive controls for TBC1D28 (1 products)

Catalog No. Species Pres. Purity   Source  

TBC1D28 overexpression lysate

TBC1D28 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn