TA334960 KCTD21 antibody

Rabbit Polyclonal Anti-KCTD21 Antibody

See related secondary antibodies

Search for all "KCTD21"

0.1 ml / $360.00
Delivery Time: 5-7 working days*
(*) valid for US customers only

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat KCTD21

Product Description for KCTD21

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat KCTD21.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCTD21

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein KCTD21
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4G0X4
Immunogen:
The immunogen for anti-KCTD21 antibody: synthetic peptide directed towards the N terminal of human KCTD21. Synthetic peptide located within the following region: RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE.
GeneID:
283219
Application WB
Background KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCTD21 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD21

KCTD21 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / $748.00
  OriGene Technologies, Inc.

Positive controls for KCTD21 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD21 overexpression lysate

KCTD21 overexpression lysate
0.1 mg / $295.00
  OriGene Technologies, Inc.
  • LinkedIn